Live website intelligence
The reservation management software | Avirato
With our reservation management software, automate all your hotel management processes. PMS, Channel Manager, Booking Engine and more.
Last refresh
Updated 14d ago
Analyst read
Professional
Detected stack
Quick read
avirato.com looks like travel. Traffic signals point to roughly 487.3K monthly visits. Current AI trust scoring is 5/100.
What to do next
50/56 fields populated (89%)
Providers with missing fields
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 6/7
Missing: aiAnalysis.visualAnalysis
Why this module matters
This page lists websites that share audience, category, or technology overlap with the current domain. Use it to discover competitors, substitutes, and adjacent players.
22places: Mehr als nur ein Reiseblog
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
Agora RN | Portal de Notícias do Rio Grande do Norte - Natal RN
Airbnb | Vakantiewoningen, houten huisjes, strandhuizen en meer
Airbnb | Kiralık tatil yerleri, kulübeler, sahil evleri ve daha fazlası
Airbnb | Vacation rentals, cabins, beach houses, & more
FAQ
Common questions about finding and comparing alternatives.
This page lists websites that share audience, category, or technology overlap with avirato.com. Each alternative includes a match score and reasons so you can evaluate relevance quickly.
Alternatives are identified using a combination of category taxonomy, technology stack overlap, traffic patterns, and audience similarity signals from the SiteJSON analysis pipeline.
Yes. Click any alternative to open its full report, or use the compare feature to see avirato.com side by side with a competitor.
Keep exploring
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Travel sites
Move from this single report into the broader market cluster.
Browse Business Travel & Hotels sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
22places.de
same_category
actividadesdeinfantilyprimaria.com
similar_rank_band
agorarn.com.br
similar_rank_band
airbnb.be
same_category
See all alternatives
View all 6 alternatives and competitors to avirato.com.