Live website intelligence
The reservation management software | Avirato
With our reservation management software, automate all your hotel management processes. PMS, Channel Manager, Booking Engine and more.
Last refresh
Updated 14d ago
Analyst read
Professional
#111.1K global rank5/100 trustTravelStale snapshot
Detected stack
WordPress
Quick read
How to read avirato.com quickly
avirato.com looks like travel. Traffic signals point to roughly 487.3K monthly visits. Current AI trust scoring is 5/100.
What to do next
- The stack appears to include WordPress.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
50/56 fields populated (89%)
Providers with missing fields
publisher: 3/5files: 2/3radar: 2/4ai: 6/7
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 6/7
Missing: aiAnalysis.visualAnalysis
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
Avirato provides an integrated software solution for the hotel industry, combining Property Management System (PMS), Channel Manager, and Booking Engine capabilities to automate reservation and operational processes.
Business ModelSaaS
Target AudienceHotel owners, hostel managers, and accommodation providers seeking to digitize and automate their reservation workflows.
Classification
CategoryTravel
Sub-CategoryBusiness Travel & Hotels
HospitalityHotel ManagementPMSSaaSChannel ManagerBooking EngineTravel Technology
Trust & Risk
Trust Assessment
Trust Score5/100
SentimentProfessional
Spam DetectionClean
Google Ads Transparency
Is AdvertiserActive Advertiser
Advertiser Names
Avirato S.L.
Advertiser IDs
AR13456480465078714369
Ad Count1
has_advertiser_idhas_creative_results
Publisher Monetization
ads.txtMissing
Monetization Signals
missing_ads_txt
IAB Taxonomy
IAB CategoryTravel
IAB Sub-CategoryBusiness Travel & Hotels
Confidence95%
HospitalityHotel ManagementPMSSaaSChannel ManagerBooking EngineTravel Technology
Business Insights
Business Model
SaaS model detected
Trust Level
Low trust with 5/100 score
Audience
Hotel owners, hostel managers, and accommodation providers seeking to digitize and automate their reservation workflows.
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Travel sites
Move from this single report into the broader market cluster.
Browse Business Travel & Hotels sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
22places.de
same_category
actividadesdeinfantilyprimaria.com
similar_rank_band
agorarn.com.br
similar_rank_band
airbnb.be
same_category
See all alternatives
View all 6 alternatives and competitors to avirato.com.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.