Quick read
How to read cocomob.com quickly
cocomob.com looks like technology & computing. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 54/100.
What to do next
- The stack appears to include Unknown.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
33/62 fields populated (53%)
1 health alerts11 providers
Providers with missing fields
ads: 0/5publisher: 2/5files: 2/3traffic: 0/16radar: 0/4
Provider health alerts
traffic: TRAFFIC_NO_DATA
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 0/5
Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals
Why this module matters
Start here before opening deeper tabs
This overview turns the raw report into a fast read: what kind of site this is, how it appears to perform, and which detail modules are most worth opening next.
- Use the SEO card to judge structure quality.
- Use traffic and rank signals to estimate market weight.
- Use business and trust modules before outreach or partnership decisions.
SEO Overview
H1 Tags0
H2 Tags6
Internal Links0
External Links9
Images14
DNS & Infrastructure
DNS ProviderZoho
Mail (MX)20 mx2.zoho.com
50 mx3.zoho.com
10 mx.zoho.com
NS Records2 records
TXT Records2 records
Traffic Stats
Domain Age5.1 years
Taxonomy
IAB CategoryTechnology & Computing
IAB Sub-CategoryAdvertising Technology
Confidence75%
advertisingad-techmarketingplatformglobalhtml-templatecryptocurrency-template
Technical Files
robots.txtMissing
sitemap.xmlMissing
AI Analysis
SummaryCocomob appears to be positioned as a global advertising platform, though the metadata reveals it uses a 'Cryptohub - Cryptocurrency HTML Template' suggesting this may be a template/demo site rather than an active business. The tagline emphasizes making advertising easy.
Business ModelSaaS/Platform (claimed), though likely Template/Marketing Site (actual)
Trust Score54/100
SentimentProfessional
Publisher / Monetization
ads.txtMissing
Monetization Signals
missing_ads_txt
Visual / Brand
Color Palette
StorageR2
Keep exploring
Keep exploring from this report
Browse the related category, topic, or technology path, open alternatives, or move into comparison when you have a second domain.
Related category
Browse Technology & Computing sites
Move from this site data report into the broader market cluster.
Use category pages when market context matters more than one domain.
Related topic
Browse Advertising Technology sites
Use the topic route when audience and editorial intent matter more than category.
Topic pages help you compare audience intent around the same domain.
Related technology
Browse Unknown websites
Pivot from one domain into a stack-based discovery path.
Technology pages help you compare implementation patterns across similar sites.
Alternatives
Open cocomob.com alternatives
Review similar domains ranked by category, audience, technology overlap, and match reasons.