Quick read
How to read cocomob.com quickly
cocomob.com looks like technology & computing. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 54/100.
What to do next
- The stack appears to include Unknown.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
33/62 fields populated (53%)
1 health alerts11 providers
Providers with missing fields
ads: 0/5publisher: 2/5files: 2/3traffic: 0/16radar: 0/4
Provider health alerts
traffic: TRAFFIC_NO_DATA
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 0/5
Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
Cocomob appears to be positioned as a global advertising platform, though the metadata reveals it uses a 'Cryptohub - Cryptocurrency HTML Template' suggesting this may be a template/demo site rather than an active business. The tagline emphasizes making advertising easy.
Business ModelSaaS/Platform (claimed), though likely Template/Marketing Site (actual)
Target AudienceAdvertisers, marketers, and businesses seeking simplified global advertising solutions
Classification
CategoryTechnology & Computing
Sub-CategoryAdvertising Technology
advertisingad-techmarketingplatformglobalhtml-templatecryptocurrency-template
Trust & Risk
Trust Assessment
Trust Score54/100
SentimentProfessional
Spam DetectionClean
Publisher Monetization
ads.txtMissing
Monetization Signals
missing_ads_txt
AI Visual Analysis
Design StyleMinimalist
VibeCalm, Modern, Soft
UI Score6/100
Detected Logo TextCocomob
IAB Taxonomy
IAB CategoryTechnology & Computing
IAB Sub-CategoryAdvertising Technology
Confidence75%
advertisingad-techmarketingplatformglobalhtml-templatecryptocurrency-template
Business Insights
Business Model
SaaS/Platform (claimed), though likely Template/Marketing Site (actual) model detected
Trust Level
Medium trust with 54/100 score
Audience
Advertisers, marketers, and businesses seeking simplified global advertising solutions
Keep exploring
Keep exploring from this report
Browse the related category, topic, or technology path, open alternatives, or move into comparison when you have a second domain.
Related category
Browse Technology & Computing sites
Move from this site data report into the broader market cluster.
Use category pages when market context matters more than one domain.
Related topic
Browse Advertising Technology sites
Use the topic route when audience and editorial intent matter more than category.
Topic pages help you compare audience intent around the same domain.
Related technology
Browse Unknown websites
Pivot from one domain into a stack-based discovery path.
Technology pages help you compare implementation patterns across similar sites.
Alternatives
Open cocomob.com alternatives
Review similar domains ranked by category, audience, technology overlap, and match reasons.