Skip to main content
Screenshot of goodhousekeeping.com

Live website intelligence

goodhousekeeping.com

Good Housekeeping: Trusted Home Advice, Product Reviews & Recipes

Discover expert-tested product reviews, modern home tips, cleaning hacks, new recipes, health advice and more from Good Housekeeping. Since 1885, we

Last refresh

Updated 3d ago

Analyst read

Professional

5/100 trustHome & Garden

Detected stack

React

Quick read

How to read goodhousekeeping.com quickly

goodhousekeeping.com looks like home & garden. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 5/100.

What to do next

  • The stack appears to include React.
  • Open the Traffic tab if you need audience scale and geography before outreach.
  • Open the Business tab if trust, monetization, or positioning is your first decision filter.

Provider Completeness

34/56 fields populated (61%)

11 providers

Providers with missing fields

ads: 0/5publisher: 3/5files: 2/3traffic: 0/10radar: 0/4
View field-level status

visual: 4/4

All expected fields present

meta: 3/3

All expected fields present

seo: 5/5

All expected fields present

dns: 4/4

All expected fields present

ads: 0/5

Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals

publisher: 3/5

Missing: directCount, resellerCount

files: 2/3

Missing: robotsSitemapUrls

traffic: 0/10

Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources

whois: 6/6

All expected fields present

radar: 0/4

Missing: globalRank, rankBucket, categories, sourceTimestamp

ai: 7/7

All expected fields present

Why this module matters

Start here before opening deeper tabs

This overview turns the raw report into a fast read: what kind of site this is, how it appears to perform, and which detail modules are most worth opening next.

  • Use the SEO card to judge structure quality.
  • Use traffic and rank signals to estimate market weight.
  • Use business and trust modules before outreach or partnership decisions.

SEO Overview

H1 Tags12
H2 Tags7
Internal Links112
External Links55
Images105

DNS & Infrastructure

DNS ProviderGoogle
Mail (MX)10 goodhousekeeping-com.mail.protection.outlook.com
NS Records4 records
TXT Records12 records

Traffic Stats

Domain Age30.5 years

Taxonomy

IAB CategoryHome & Garden
IAB Sub-CategoryHome Improvement & Decor
Confidence95%
home decorproduct reviewsrecipeslifestylecleaninghealthfamilywomen's interestmagazineeditorial

Technical Files

robots.txtFound
sitemap.xmlMissing

AI Analysis

SummaryGood Housekeeping is a long-established lifestyle media brand and magazine offering expert-tested product reviews, home tips, recipes, cleaning hacks, and health advice. Operated by Hearst Communications, it combines editorial content with product testing and certification programs.
Business ModelMedia/Publishing
Trust Score5/100
SentimentProfessional

Publisher / Monetization

ads.txtFound
Ad Systems
hearst.comaps.amazon.comappnexus.comblis.comcontextweb.comconversantmedia.comgoogle.comgumgum.comindexexchange.comkargo.comliveintent.commedia.netopenx.comoptoutadvertising.comoutbrain.comrubiconproject.comsharethrough.comsmartadserver.comsmartclip.nettaboola.comteads.tvthemediagrid.comtriplelift.comvideo.unrulymedia.comyahoo.comyieldmo.com
Monetization Signals
has_ads_txthas_ad_systems

Visual / Brand

Dominant Color#100100100
Color Palette
StorageR2

Keep exploring

Keep exploring from this report

Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.

Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.