Live website intelligence
Irvine, California, United States
Irvine, California, United States | General information, Weather, News, Directories (Doctors, Lawyers, Education, Pets, Churches), Classifieds, Maps, Travel and More
Last refresh
Updated 45d ago
Analyst read
Professional
34/100 trustNews / Weather / InformationStale snapshot
Detected stack
Cloudflare
Quick read
How to read irvinegrid.com quickly
irvinegrid.com looks like news / weather / information. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 34/100.
What to do next
- The stack appears to include Cloudflare.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
41/56 fields populated (73%)
Providers with missing fields
visual: 3/4traffic: 0/10radar: 0/4
View field-level status
visual: 3/4
Missing: screenshotUrl
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 5/5
All expected fields present
files: 3/3
All expected fields present
traffic: 0/10
Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources
whois: 6/6
All expected fields present
radar: 0/4
Missing: globalRank, rankBucket, categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
A city-focused local portal for Irvine that aggregates community information, directories, weather, news, classifieds, and local service listings.
Business ModelMedia
Target AudienceResidents, visitors, and local businesses in or around Irvine, California seeking community resources and local updates.
Classification
CategoryNews / Weather / Information
Sub-CategoryLocal News
Irvinelocal directorycommunity portalweathernewsclassifiedsmapsservices
Trust & Risk
Trust Assessment
Trust Score34/100
SentimentProfessional
Spam DetectionClean
Google Ads Transparency
Is AdvertiserNot Advertising
Ad Count0
no_advertiser_idno_creative_results
Publisher Monetization
ads.txtFound
Ad Systems
google.com
Direct Sellers1
Reseller Sellers0
Monetization Signals
has_ads_txthas_ad_systems
AI Visual Analysis
Design StylePortal-style / Promotional
VibeLocal, Informational, Promotional
UI Score5/100
Detected Logo TextThe Irvine Grid
IAB Taxonomy
IAB CategoryNews / Weather / Information
IAB Sub-CategoryLocal News
Confidence86%
Irvinelocal directorycommunity portalweathernewsclassifiedsmapsservices
Business Insights
Business Model
Media model detected
Trust Level
Low trust with 34/100 score
Audience
Residents, visitors, and local businesses in or around Irvine, California seeking community resources and local updates.
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse News / Weather / Information sites
Move from this single report into the broader market cluster.
Browse Local News sites
Use the topic route when audience and editorial intent matter more than category.
Browse Cloudflare websites
Pivot from one domain into a stack-based discovery path.
infooggi.it
same_category
infokava.com
same_category
infonegocios.info
same_category
infoport.am
same_category
See all alternatives
View all 6 alternatives and competitors to irvinegrid.com.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.