Live website intelligence
Irvine, California, United States
Irvine, California, United States | General information, Weather, News, Directories (Doctors, Lawyers, Education, Pets, Churches), Classifieds, Maps, Travel and More
Last refresh
Updated 41d ago
Analyst read
Professional
34/100 trustNews / Weather / InformationStale snapshot
Detected stack
Cloudflare
Quick read
How to read irvinegrid.com quickly
irvinegrid.com looks like news / weather / information. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 34/100.
What to do next
- The stack appears to include Cloudflare.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
41/56 fields populated (73%)
Providers with missing fields
visual: 3/4traffic: 0/10radar: 0/4
View field-level status
visual: 3/4
Missing: screenshotUrl
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 5/5
All expected fields present
files: 3/3
All expected fields present
traffic: 0/10
Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources
whois: 6/6
All expected fields present
radar: 0/4
Missing: globalRank, rankBucket, categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Use the SEO tab as a quality and discoverability check
These metrics help you decide whether a site is structured clearly enough for search and users. Strong heading, linking, and technical file patterns usually indicate better discoverability.
- Check heading counts to spot thin or messy structure.
- Review robots and sitemap presence before treating a site as search-mature.
- Use taxonomy and AI notes to understand topical fit.
Heading Structure
H1 Tags1
H2 Tags2
Images4
Link Analysis
Internal Links1890
External Links27
Link Ratio99% internal
Technical Files Checklist
robots.txt
File found and accessible
sitemap.xml
Sitemap not found
Single H1 Tag
Page has exactly one H1
Meta Description
Meta description present
Taxonomy
News / Weather / InformationLocal News86%
Irvinelocal directorycommunity portalweathernewsclassifiedsmapsservices
AI Classification
Content Analysis
CategoryNews / Weather / Information
Business ModelMedia
Trust Score34/100
SentimentProfessional
AI-Generated Tags
Irvinelocal directorycommunity portalweathernewsclassifiedsmapsservices
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse News / Weather / Information sites
Move from this single report into the broader market cluster.
Browse Local News sites
Use the topic route when audience and editorial intent matter more than category.
Browse Cloudflare websites
Pivot from one domain into a stack-based discovery path.
itvbd.net
same_category
adland.tv
same_category
0215rhrfhh79.top
same_category
iqy-jezy.online
high_tag_overlap
See all alternatives
View all 6 alternatives and competitors to irvinegrid.com.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.