Live website intelligence
Shop freelance services with confidence on Kwork. Offers start at $10.
Order the service you need, provide your requirements and start saving!<br /> Results are guaranteed and payments secure. And if something goes wrong, you
Last refresh
Updated 53d ago
Analyst read
Professional
15/100 trustBusiness & IndustrialStale snapshot
Detected stack
WordPress
Quick read
How to read kwork.com quickly
kwork.com looks like business & industrial. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 15/100.
What to do next
- The stack appears to include WordPress.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
34/56 fields populated (61%)
Providers with missing fields
ads: 0/5publisher: 3/5files: 2/3traffic: 0/10radar: 0/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 0/5
Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 0/10
Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources
whois: 6/6
All expected fields present
radar: 0/4
Missing: globalRank, rankBucket, categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Start here before opening deeper tabs
This overview turns the raw report into a fast read: what kind of site this is, how it appears to perform, and which detail modules are most worth opening next.
- Use the SEO card to judge structure quality.
- Use traffic and rank signals to estimate market weight.
- Use business and trust modules before outreach or partnership decisions.
SEO Overview
H1 Tags1
H2 Tags5
Internal Links41
External Links128
Images76
DNS & Infrastructure
DNS ProviderGoogle
Mail (MX)10 mailgw.mirafox.ru
NS Records4 records
TXT Records5 records
Traffic Stats
Domain Age16.3 years
Taxonomy
IAB CategoryBusiness & Industrial
IAB Sub-CategoryEmployment & Careers
Confidence92%
freelancemarketplaceservicesgig economyoutsourcingweb designdevelopmentdigital marketing
Technical Files
robots.txtFound
sitemap.xmlFound
AI Analysis
SummaryKwork is an online freelance marketplace platform connecting buyers with freelancers offering various digital services including design, development, writing, SEO, marketing, and more. Services start at $10 with a focus on affordability and quick turnaround.
Business ModelMarketplace (Two-sided platform)
Trust Score15/100
SentimentProfessional
Publisher / Monetization
ads.txtMissing
Monetization Signals
missing_ads_txt
Visual / Brand
Dominant Color#100100100
Color Palette
StorageR2
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Business & Industrial sites
Move from this single report into the broader market cluster.
Browse Employment & Careers sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
amplity.com
same_category
ataphotobooths.com
same_category
ascentco.com
same_category
airq.com
same_category
See all alternatives
View all 6 alternatives and competitors to kwork.com.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.