Live website intelligence
Shop freelance services with confidence on Kwork. Offers start at $10.
Order the service you need, provide your requirements and start saving!<br /> Results are guaranteed and payments secure. And if something goes wrong, you
Last refresh
Updated 58d ago
Analyst read
Professional
15/100 trustBusiness & IndustrialStale snapshot
Detected stack
WordPress
Quick read
How to read kwork.com quickly
kwork.com looks like business & industrial. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 15/100.
What to do next
- The stack appears to include WordPress.
- Open the Traffic tab if you need audience scale and geography before outreach.
- Open the Business tab if trust, monetization, or positioning is your first decision filter.
Provider Completeness
34/56 fields populated (61%)
Providers with missing fields
ads: 0/5publisher: 3/5files: 2/3traffic: 0/10radar: 0/4
View field-level status
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 0/5
Missing: isAdvertiser, advertiserIds, advertiserNames, resultCount, transparencySignals
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 0/10
Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources
whois: 6/6
All expected fields present
radar: 0/4
Missing: globalRank, rankBucket, categories, sourceTimestamp
ai: 7/7
All expected fields present
Why this module matters
Business signals help answer “is this a real opportunity?”
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
- Trust score and sentiment are your first risk screen.
- Business summary and audience notes speed up qualification.
- Ads and monetization patterns reveal how the site captures value.
Business Intelligence
Business Profile
Kwork is an online freelance marketplace platform connecting buyers with freelancers offering various digital services including design, development, writing, SEO, marketing, and more. Services start at $10 with a focus on affordability and quick turnaround.
Business ModelMarketplace (Two-sided platform)
Target AudienceSmall businesses, startups, entrepreneurs, and individuals seeking affordable freelance services; also freelancers looking for work opportunities
Classification
CategoryBusiness & Industrial
Sub-CategoryEmployment & Careers
freelancemarketplaceservicesgig economyoutsourcingweb designdevelopmentdigital marketing
Trust & Risk
Trust Assessment
Trust Score15/100
SentimentProfessional
Spam DetectionClean
Publisher Monetization
ads.txtMissing
Monetization Signals
missing_ads_txt
AI Visual Analysis
Design StyleCorporate
VibeProfessional
UI Score7/100
Detected Logo TextKWORK PROFESSIONAL SERVICES
IAB Taxonomy
IAB CategoryBusiness & Industrial
IAB Sub-CategoryEmployment & Careers
Confidence92%
freelancemarketplaceservicesgig economyoutsourcingweb designdevelopmentdigital marketing
Business Insights
Business Model
Marketplace (Two-sided platform) model detected
Trust Level
Low trust with 15/100 score
Audience
Small businesses, startups, entrepreneurs, and individuals seeking affordable freelance services; also freelancers looking for work opportunities
Keep exploring
Keep exploring from this report
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Business & Industrial sites
Move from this single report into the broader market cluster.
Browse Employment & Careers sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
adevinta.com
same_category
adequasys.com
same_category
adec-innovations.com
same_category
adexpo.es
same_category
See all alternatives
View all 6 alternatives and competitors to kwork.com.
Need fresh data for another site? Trigger a fresh analysis or open the directory to continue browsing.