Quick read
actividadesdeinfantilyprimaria.com looks like education. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 46/100.
What to do next
38/56 fields populated (68%)
Providers with missing fields
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 0/10
Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources
whois: 6/6
All expected fields present
radar: 0/4
Missing: globalRank, rankBucket, categories, sourceTimestamp
ai: 6/7
Missing: aiAnalysis.visualAnalysis
Keep exploring
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Education sites
Move from this single report into the broader market cluster.
Browse K-12 Education sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
academicon.pl
same_category
aosis.co.za
same_category
amdisa.org
same_category
isae.fr
same_category
See all alternatives
View all 6 alternatives and competitors to actividadesdeinfantilyprimaria.com.
Why this module matters
This page lists websites that share audience, category, or technology overlap with the current domain. Use it to discover competitors, substitutes, and adjacent players.
Serwisy - Portal Academicon
AOSIS - Unlock Knowledge to the World
AMDISA - Home Page
Institut Supérieur de l'Aéronautique et de l'Espace | ISAE-SUPAERO
Home - Best College Tutors
Business & Corporate Sustainability Training Courses | ISS
FAQ
Common questions about finding and comparing alternatives.
This page lists websites that share audience, category, or technology overlap with actividadesdeinfantilyprimaria.com. Each alternative includes a match score and reasons so you can evaluate relevance quickly.
Alternatives are identified using a combination of category taxonomy, technology stack overlap, traffic patterns, and audience similarity signals from the SiteJSON analysis pipeline.
Yes. Click any alternative to open its full report, or use the compare feature to see actividadesdeinfantilyprimaria.com side by side with a competitor.