Live website intelligence
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
Recursos para trabajar en infantil y primaria
Last refresh
Updated 9d ago
Analyst read
Professional
Detected stack
Quick read
actividadesdeinfantilyprimaria.com looks like education. Traffic signals point to roughly 435.2K monthly visits. Current AI trust scoring is 46/100.
What to do next
50/56 fields populated (89%)
Providers with missing fields
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 10/10
All expected fields present
whois: 6/6
All expected fields present
radar: 2/4
Missing: categories, sourceTimestamp
ai: 6/7
Missing: aiAnalysis.visualAnalysis
Why this module matters
Use the business tab to understand trust, monetization, audience fit, and brand posture before you spend time on outreach, partnerships, or competitive teardown work.
Spanish-language website providing teaching resources and classroom activities for preschool (infantil) and primary (primaria) education.
Monetization Signals
Media/Content (educational blog/resources, likely ad-supported) model detected
Medium trust with 46/100 score
Teachers and educators of early childhood and primary grades, plus parents/guardians looking for learning activities.
Keep exploring
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Education sites
Move from this single report into the broader market cluster.
Browse K-12 Education sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
atu.edu
same_category
academicon.pl
same_category
aosis.co.za
same_category
apeaksoft.com
similar_rank_band
See all alternatives
View all 6 alternatives and competitors to actividadesdeinfantilyprimaria.com.