Quick read
actividadesdeinfantilyprimaria.com looks like education. Traffic estimates are limited, so use the trust and structure modules first. Current AI trust scoring is 46/100.
What to do next
38/56 fields populated (68%)
Providers with missing fields
visual: 4/4
All expected fields present
meta: 3/3
All expected fields present
seo: 5/5
All expected fields present
dns: 4/4
All expected fields present
ads: 5/5
All expected fields present
publisher: 3/5
Missing: directCount, resellerCount
files: 2/3
Missing: robotsSitemapUrls
traffic: 0/10
Missing: monthlyVisits, globalRank, countryRank, bounceRate, avgVisitDuration, pagesPerVisit, topCountry, topRegions, topKeywords, trafficSources
whois: 6/6
All expected fields present
radar: 0/4
Missing: globalRank, rankBucket, categories, sourceTimestamp
ai: 6/7
Missing: aiAnalysis.visualAnalysis
Why this module matters
Use rank, visits, geography, and engagement signals together. No single metric is enough, but the combination is useful for prioritization and market sizing.
—
—
—
Monthly
—
—
—
Domain Age
10.9 years
Registrar
Soluciones Corporativas IP, SL
Created At
Mar 19, 2015, 11:23 AM
Updated At
Feb 17, 2026, 09:42 AM
Expires At
Mar 19, 2027, 11:23 AM
Nameservers
Status
Keep exploring
Good pSEO pages should not strand the visitor. These links keep the journey moving through adjacent directories and comparable live reports.
Browse Education sites
Move from this single report into the broader market cluster.
Browse K-12 Education sites
Use the topic route when audience and editorial intent matter more than category.
Browse Wordpress websites
Pivot from one domain into a stack-based discovery path.
academicon.pl
same_category
aosis.co.za
same_category
amdisa.org
same_category
isae.fr
same_category
See all alternatives
View all 6 alternatives and competitors to actividadesdeinfantilyprimaria.com.